PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011099212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 338aa    MW: 37764.1 Da    PI: 7.1938
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011099212.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-4271061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk lrrkC+++Cv+apyfp ++p+kf nvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++++l+
  XP_011099212.1   7 PCAACKCLRRKCTQECVFAPYFPPDNPQKFTNVHKVFGASNVAKLLNELNASQREDAVNSLAYEAEYRLRDPVYGCVGLISILQHKLKQVQHDLD 101
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      +k+e
  XP_011099212.1 102 NAKKE 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4366107IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MSSSNSPCAA CKCLRRKCTQ ECVFAPYFPP DNPQKFTNVH KVFGASNVAK LLNELNASQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISILQ HKLKQVQHDL DNAKKELATY IGPSAMLPIL  120
NHPGFMQQHP NYAPSAYQVM PYNVQPMMGL PTGVPHGAQL MIREPQQQQQ QQQFLEAQAA  180
AAAREQEMLR TYEQQQQQQQ NDLVRFNSGF DDAAGPVPAT GFNQIPAAAG AAMQPSLALG  240
SSYETLPYHH IQQHGNVQEH SQTQSHTHSH HPHGHQLPLQ PHELLLQQQQ QQQNVSTHHQ  300
QQQQQQTQQQ LGQPQPSHSQ QQPPRAKSEE GRSIGPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0545567e-84KJ054556.1 Sesamum indicum clone TilSSR_25757 microsatellite Sesame_25757 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099212.10.0PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ32e-86LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-120A0A0B0PS92_G
STRINGSolyc02g065150.1.11e-114(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-79ASYMMETRIC LEAVES 2-like 1